IBA57 polyclonal antibody View larger

IBA57 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of IBA57 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about IBA57 polyclonal antibody

Brand: Abnova
Reference: PAB22757
Product name: IBA57 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant IBA57.
Isotype: IgG
Gene id: 200205
Gene name: IBA57
Gene alias: RP11-520H14.5|C1orf69
Gene description: IBA57, iron-sulfur cluster assembly homolog (S. cerevisiae)
Immunogen: Recombinant protein corresponding to amino acids of human IBA57.
Immunogen sequence/protein sequence: WRLLTQDEGPALVPGGRLGDLWDYHQHRYLQGVPEGVRDLPPGVALPLESNLAFMNGVSFTKGCYIGQELTARTHHMGVIRKRL
Protein accession: Q5T440
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB22757-48-33-1.jpg
Application image note: Immunohistochemical staining of human prostate with IBA57 polyclonal antibody (Cat # PAB22757) strong cytoplasmic positivity in glandular cells.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy IBA57 polyclonal antibody now

Add to cart