NCOA7 polyclonal antibody View larger

NCOA7 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NCOA7 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about NCOA7 polyclonal antibody

Brand: Abnova
Reference: PAB22753
Product name: NCOA7 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant NCOA7.
Isotype: IgG
Gene id: 135112
Gene name: NCOA7
Gene alias: ERAP140|ESNA1|FLJ45605|MGC88425|Nbla00052|Nbla10993|dJ187J11.3
Gene description: nuclear receptor coactivator 7
Immunogen: Recombinant protein corresponding to amino acids of human NCOA7.
Immunogen sequence/protein sequence: HGSPTVTKLSKEPSDTSAAFESTAKENFLGEDDDFVDLEELSSQTGGGMHKKDTLKECLSLDPEERKKAESQINNSAVEMQVQS
Protein accession: Q8NI08
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB22753-48-52-1.jpg
Application image note: Immunohistochemical staining of human cerebellum with NCOA7 polyclonal antibody (Cat # PAB22753) shows strong cytoplasmic and nuclear positivity in Purkinje cells at 1:200-1:500 dilution.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy NCOA7 polyclonal antibody now

Add to cart