PLXNA4 polyclonal antibody View larger

PLXNA4 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PLXNA4 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about PLXNA4 polyclonal antibody

Brand: Abnova
Reference: PAB22749
Product name: PLXNA4 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant PLXNA4.
Isotype: IgG
Gene id: 91584
Gene name: PLXNA4
Gene alias: DKFZp434G0625|DKFZp566O0546|FAYV2820|FLJ35026|FLJ38287|KIAA1550|PLEXA4|PLXNA4A|PLXNA4B|PRO34003
Gene description: plexin A4
Immunogen: Recombinant protein corresponding to amino acids of human PLXNA4.
Immunogen sequence/protein sequence: SHVKVAGVECSPLVDGYIPAEQIVCEMGEAKPSQHAGFVEICVAVCRPEFMARSSQLYYFMTLTLSDLKPSRGPMSGGTQVTI
Protein accession: Q9HCM2
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB22749-48-2-1.jpg
Application image note: Immunohistochemical staining of human kidney with PLXNA4 polyclonal antibody (Cat # PAB22749) shows moderate cytoplasmic positivity in tubular cells.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy PLXNA4 polyclonal antibody now

Add to cart