RNF160 polyclonal antibody View larger

RNF160 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RNF160 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about RNF160 polyclonal antibody

Brand: Abnova
Reference: PAB22743
Product name: RNF160 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant RNF160.
Isotype: IgG
Gene id: 26046
Gene name: RNF160
Gene alias: C21orf10|C21orf98|FLJ11053|KIAA0714|ZNF294
Gene description: ring finger protein 160
Immunogen: Recombinant protein corresponding to amino acids of human RNF160.
Immunogen sequence/protein sequence: LMGVYIGSVMPNDSEWEKMRQSLPMQWLHRPLLEGRLSLNYECFKTDFKEQDIKTLPSHLCTSALLSKMVLIALRKETVL
Protein accession: O94822
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB22743-48-42-1.jpg
Application image note: Immunohistochemical staining of human breast with RNF160 polyclonal antibody (Cat # PAB22743) strong cytoplasmic positivity in glandular cells.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy RNF160 polyclonal antibody now

Add to cart