AZI2 polyclonal antibody View larger

AZI2 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of AZI2 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about AZI2 polyclonal antibody

Brand: Abnova
Reference: PAB22724
Product name: AZI2 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant AZI2.
Isotype: IgG
Gene id: 64343
Gene name: AZI2
Gene alias: AZ2|NAP1|TILP
Gene description: 5-azacytidine induced 2
Immunogen: Recombinant protein corresponding to amino acids of human AZI2.
Immunogen sequence/protein sequence: DKMNKDNSESLKVLNEQLQSKEVELLQLRTEVETQQVMRNLNPPSSNWEVEKLSCDLKIHGLEQELELMRKECSDLKIELQKAKQT
Protein accession: Q9H6S1
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB22724-48-A3-1.jpg
Application image note: Immunohistochemical staining of human stomach with AZI2 polyclonal antibody (Cat # PAB22724) shows strong cytoplasmic positivity in Parietal cells at 1:200-1:500 dilution.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy AZI2 polyclonal antibody now

Add to cart