PRSS36 polyclonal antibody View larger

PRSS36 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PRSS36 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about PRSS36 polyclonal antibody

Brand: Abnova
Reference: PAB22704
Product name: PRSS36 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant PRSS36.
Isotype: IgG
Gene id: 146547
Gene name: PRSS36
Gene alias: FLJ90661
Gene description: protease, serine, 36
Immunogen: Recombinant protein corresponding to amino acids of human PRSS36.
Immunogen sequence/protein sequence: WVLGWKEPQDRVPVAAAVSILTQRICDCLYQGILPPGTLCVLYAEGQENRCEMTSAPPLLCQMTEGSWIPVGMAVQGSRELFAAIG
Protein accession: Q5K4E3
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB22704-48-A2-1.jpg
Application image note: Immunohistochemical staining of human colon with PRSS36 polyclonal antibody (Cat # PAB22704) strong cytoplasmic positivity in glandular cells.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy PRSS36 polyclonal antibody now

Add to cart