ABCB7 polyclonal antibody View larger

ABCB7 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ABCB7 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,IF

More info about ABCB7 polyclonal antibody

Brand: Abnova
Reference: PAB22645
Product name: ABCB7 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant ABCB7.
Isotype: IgG
Gene id: 22
Gene name: ABCB7
Gene alias: ABC7|ASAT|Atm1p|EST140535
Gene description: ATP-binding cassette, sub-family B (MDR/TAP), member 7
Immunogen: Recombinant protein corresponding to amino acids of human ABCB7.
Immunogen sequence/protein sequence: GAMKDVVKHRTSIFIAHRLSTVVDADEIIVLDQGKVAERGTHHGLLANPHSIYSEMWHTQSSRVQNHDNPKWEAKKENISKEEERKKLQEEI
Protein accession: O75027
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:200-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB22645-49-23-1.jpg
Application image note: Immunofluorescent staining of human cell line U-2 OS with ABCB7 polyclonal antibody (Cat # PAB22645) at 1-4 ug/mL dilution shows positivity in cytoplasm and mitochondria.
Applications: IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy ABCB7 polyclonal antibody now

Add to cart