GNB1L polyclonal antibody View larger

GNB1L polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GNB1L polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about GNB1L polyclonal antibody

Brand: Abnova
Reference: PAB22629
Product name: GNB1L polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant GNB1L.
Isotype: IgG
Gene id: 54584
Gene name: GNB1L
Gene alias: DGCRK3|FKSG1|GY2|KIAA1645|WDR14|WDVCF
Gene description: guanine nucleotide binding protein (G protein), beta polypeptide 1-like
Immunogen: Recombinant protein corresponding to amino acids of human GNB1L.
Immunogen sequence/protein sequence: VDSVCLESVGFCRSSILAGGQPRWTLAVPGRGSDEVQILEMPSKTSVCALKPKADAKLGMPMCLRLWQADCSSRPLLLAGYEDGSVVL
Protein accession: Q9BYB4
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB22629-48-2-1.jpg
Application image note: Immunohistochemical staining of human kidney with GNB1L polyclonal antibody (Cat # PAB22629) shows moderate cytoplasmic positivity in tubular cells at 1:50-1:200 dilution.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy GNB1L polyclonal antibody now

Add to cart