NALCN polyclonal antibody View larger

NALCN polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NALCN polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about NALCN polyclonal antibody

Brand: Abnova
Reference: PAB22599
Product name: NALCN polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant NALCN.
Isotype: IgG
Gene id: 259232
Gene name: NALCN
Gene alias: CanIon|FLJ23913|FLJ44659|FLJ44764|MGC74524|VGCNL1|bA430M15.1
Gene description: sodium leak channel, non-selective
Immunogen: Recombinant protein corresponding to amino acids of human NALCN.
Immunogen sequence/protein sequence: GKSLETLTQDHSNTVRYRNAQREDSEIKMIQEKKEQAEMKRKVQEEELRENHPYFDKPLFIVGREHRFRNFCRVVVRARFNASKTD
Protein accession: Q8IZF0
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB22599-48-223-1.jpg
Application image note: Immunohistochemical staining of human hippocampus with NALCN polyclonal antibody (Cat # PAB22599) shows moderate granular positivity in neuronal cells and neuropil.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy NALCN polyclonal antibody now

Add to cart