HRNR polyclonal antibody View larger

HRNR polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HRNR polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about HRNR polyclonal antibody

Brand: Abnova
Reference: PAB22558
Product name: HRNR polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant HRNR.
Isotype: IgG
Gene id: 388697
Gene name: HRNR
Gene alias: S100A16|S100a18
Gene description: hornerin
Immunogen: Recombinant protein corresponding to amino acids of human HRNR.
Immunogen sequence/protein sequence: WSAGENDSYSRNVRGSLKPGTESISRRLSFQRDFSGQHNSYSGQSSSYGEQNSDSHQSSGRGQCGSGS
Protein accession: Q86YZ3
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB22558-48-72-1.jpg
Application image note: Immunohistochemical staining of human skin with HRNR polyclonal antibody (Cat # PAB22558) shows distinct positivity in granular layer cells.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy HRNR polyclonal antibody now

Add to cart