LACE1 polyclonal antibody View larger

LACE1 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of LACE1 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,WB-Tr

More info about LACE1 polyclonal antibody

Brand: Abnova
Reference: PAB22475
Product name: LACE1 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant LACE1.
Isotype: IgG
Gene id: 246269
Gene name: LACE1
Gene alias: AFG1
Gene description: lactation elevated 1
Immunogen: Recombinant protein corresponding to amino acids of human LACE1.
Immunogen sequence/protein sequence: TFEELCERPLGASDYLELSKNFDTIFLRNIPQFTLANRTQGRRFITLIDNFYDLKVRIICSASTPISSLFLHQHHDSELEQSRILMDDLGLSQDSAEGLSMFTG
Protein accession: Q8WV93
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:10-1:20)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB22475-48-42-1.jpg
Application image note: Immunohistochemical staining of human breast with LACE1 polyclonal antibody (Cat # PAB22475) shows distinct cytoplasmic positivity in glandular cells.
Applications: IHC-P,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy LACE1 polyclonal antibody now

Add to cart