KIRREL polyclonal antibody View larger

KIRREL polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of KIRREL polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about KIRREL polyclonal antibody

Brand: Abnova
Reference: PAB22451
Product name: KIRREL polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant KIRREL.
Isotype: IgG
Gene id: 55243
Gene name: KIRREL
Gene alias: FLJ10845|MGC129542|MGC129543|NEPH1
Gene description: kin of IRRE like (Drosophila)
Immunogen: Recombinant protein corresponding to amino acids of human KIRREL.
Immunogen sequence/protein sequence: VTLSIEPQTVQEGERVVFTCQATANPEILGYRWAKGGFLIEDAHESRYETNVDYSFFTEPVSCEVHNKVGSTNVSTLVNVHFAPRIVVDPKPTTTDIGSDVTLTCVWVGNPPLTLTWTKKDSNMVLSNSNQLLLKSVTQADA
Protein accession: Q96J84
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB22451-48-2-1.jpg
Application image note: Immunohistochemical staining of human kidney with KIRREL polyclonal antibody (Cat # PAB22451) shows cytoplasmic positivity in podocytes in glomeruli.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy KIRREL polyclonal antibody now

Add to cart