SLC35D3 polyclonal antibody View larger

SLC35D3 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SLC35D3 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about SLC35D3 polyclonal antibody

Brand: Abnova
Reference: PAB22447
Product name: SLC35D3 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant SLC35D3.
Isotype: IgG
Gene id: 340146
Gene name: SLC35D3
Gene alias: FRCL1|MGC102873|bA55K22.3
Gene description: solute carrier family 35, member D3
Immunogen: Recombinant protein corresponding to amino acids of human SLC35D3.
Immunogen sequence/protein sequence: RKQSNYEDLEAQPRGEEAQLSGDQLPFVMEELPGEGGNGRSEGGEAAGGPAQESRQEVRGSPRGVPLVAGSSEEGSRRSLKDAYLEVWRLVRGTRYM
Protein accession: Q5M8T2
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB22447-48-305-1.jpg
Application image note: Immunohistochemical staining of human bronchus with SLC35D3 polyclonal antibody (Cat # PAB22447) shows strong cytoplasmic positivity, with a granular pattern, in respiratory epithelial cells.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy SLC35D3 polyclonal antibody now

Add to cart