SLC37A1 polyclonal antibody View larger

SLC37A1 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SLC37A1 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about SLC37A1 polyclonal antibody

Brand: Abnova
Reference: PAB22445
Product name: SLC37A1 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant SLC37A1.
Isotype: IgG
Gene id: 54020
Gene name: SLC37A1
Gene alias: FLJ22340|G3PP
Gene description: solute carrier family 37 (glycerol-3-phosphate transporter), member 1
Immunogen: Recombinant protein corresponding to amino acids of human SLC37A1.
Immunogen sequence/protein sequence: IVKGELHKYCTAWDEADVRFSSQNRKSGSAAPHQLPDNETDCGWAPFDKNNY
Protein accession: P57057
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB22445-48-I6-1.jpg
Application image note: Immunohistochemical staining of human duodenum with SLC37A1 polyclonal antibody (Cat # PAB22445) shows strong granular positivity in glandular cells.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy SLC37A1 polyclonal antibody now

Add to cart