YRDC polyclonal antibody View larger

YRDC polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of YRDC polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about YRDC polyclonal antibody

Brand: Abnova
Reference: PAB22400
Product name: YRDC polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant YRDC.
Isotype: IgG
Gene id: 79693
Gene name: YRDC
Gene alias: DRIP3|FLJ23476|FLJ26165|IRIP|RP11-109P14.4|SUA5
Gene description: yrdC domain containing (E. coli)
Immunogen: Recombinant protein corresponding to amino acids of human YRDC.
Immunogen sequence/protein sequence: ASSLNVEEFQDLWPQLSLVIDGGQIGDGQSPECRLGSTVVDLSVPGKFGIIRPGCALESTTAILQQKYGLLP
Protein accession: Q86U90
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB22400-48-A7-1.jpg
Application image note: Immunohistochemical staining of human pancreas with YRDC polyclonal antibody (Cat # PAB22400) shows strong cytoplasmic positivity in exocrine glandular cells and Islet cells.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy YRDC polyclonal antibody now

Add to cart