RWDD2A polyclonal antibody View larger

RWDD2A polyclonal antibody

PAB22392_100uL

New product

455,00 € tax excl.

100 UL

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RWDD2A polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,WB-Tr

More info about RWDD2A polyclonal antibody

Brand: Abnova
Reference: PAB22392
Product name: RWDD2A polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant RWDD2A.
Isotype: IgG
Gene id: 112611
Gene name: RWDD2A
Gene alias: MGC13523|MGC138208|RWDD2|dJ747H23.2
Gene description: RWD domain containing 2A
Immunogen: Recombinant protein corresponding to amino acids of human RWDD2A.
Immunogen sequence/protein sequence: IICVEGFKEHCEEFWHTIRYPNWKHISCKHAESVETEGNGEDLRLFHSFEELLLEAHGDYGLRNDYHMNLGQFLEFLKKHKSEHVFQILFGIESKSSDS
Protein accession: Q9UIY3
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB22392-48-41-1.jpg
Application image note: Immunohistochemical staining of human placenta with RWDD2A polyclonal antibody (Cat # PAB22392) shows strong nuclear positivity in trophoblastic cells at 1:200-1:500 dilution.
Applications: IHC-P,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy RWDD2A polyclonal antibody now

Add to cart