INSL5 polyclonal antibody View larger

INSL5 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of INSL5 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,WB-Tr

More info about INSL5 polyclonal antibody

Brand: Abnova
Reference: PAB22388
Product name: INSL5 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant INSL5.
Isotype: IgG
Gene id: 10022
Gene name: INSL5
Gene alias: MGC126695|MGC126697|PRO182|UNQ156
Gene description: insulin-like 5
Immunogen: Recombinant protein corresponding to amino acids of human INSL5.
Immunogen sequence/protein sequence: LEYIRTVIYICASSRWRRHLEGIPQAQQAETGNSFQLPHKREFSEENPAQNLPKVDASGEDRLWGGQMPTEELWKSKKHSVMSR
Protein accession: Q9Y5Q6
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB22388-48-72-1.jpg
Application image note: Immunohistochemical staining of human skin with INSL5 polyclonal antibody (Cat # PAB22388) shows distinct positivity in Langerhans cells.
Applications: IHC-P,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy INSL5 polyclonal antibody now

Add to cart