RNF187 polyclonal antibody View larger

RNF187 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RNF187 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about RNF187 polyclonal antibody

Brand: Abnova
Reference: PAB22386
Product name: RNF187 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant RNF187.
Isotype: IgG
Gene id: 149603
Gene name: RNF187
Gene alias: -
Gene description: ring finger protein 187
Immunogen: Recombinant protein corresponding to amino acids of human RNF187.
Immunogen sequence/protein sequence: HVMDRRKKALTDYKKLRAFFVEEEEHFLQEAEKEEGLPEDELADPTERFRSLLQAVSELEKKHRNLGLSMLLQ
Protein accession: Q5TA31
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB22386-48-12-1.jpg
Application image note: Immunohistochemical staining of human testis with RNF187 polyclonal antibody (Cat # PAB22386) shows strong nuclear and cytoplasmic positivity in cells of seminiferus ducts.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy RNF187 polyclonal antibody now

Add to cart