CEP85L polyclonal antibody View larger

CEP85L polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CEP85L polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about CEP85L polyclonal antibody

Brand: Abnova
Reference: PAB22253
Product name: CEP85L polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant CEP85L.
Isotype: IgG
Gene id: 387119
Gene name: CEP85L
Gene alias: RP11-57K17.2|C6orf204|NY-BR-15|bA57K17.2
Gene description: centrosomal protein 85kDa-like
Immunogen: Recombinant protein corresponding to amino acids of human CEP85L.
Immunogen sequence/protein sequence: LDCKYKFESCSKEDFRASSSTLRRQPVDMTYSALPESKPIMTSSEAFEPPKYLMLGQQAVGGVPIQPSVRTQMW
Protein accession: Q5SZL2
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB22253-48-A1-1.jpg
Application image note: Immunohistochemical staining of human liver with CEP85L polyclonal antibody (Cat # PAB22253) shows strong cytoplasmic and nuclear positivity in hepatocytes at 1:20-1:50 dilution.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy CEP85L polyclonal antibody now

Add to cart