ZNF354B polyclonal antibody View larger

ZNF354B polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ZNF354B polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,WB-Tr

More info about ZNF354B polyclonal antibody

Brand: Abnova
Reference: PAB22244
Product name: ZNF354B polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant ZNF354B.
Isotype: IgG
Gene id: 117608
Gene name: ZNF354B
Gene alias: FLJ25008|KID2|MGC138316
Gene description: zinc finger protein 354B
Immunogen: Recombinant protein corresponding to amino acids of human ZNF354B.
Immunogen sequence/protein sequence: CKSTPKMTKSTQTQDSFQEQIRKRLKRDEPWNFISERSCIYEEKLKKQQDKNENLQIISVAHTKILTVDRSHKNVEFGQNFYLKSVFIKQ
Protein accession: Q96LW1
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB22244-48-A2-1.jpg
Application image note: Immunohistochemical staining of human colon with ZNF354B polyclonal antibody (Cat # PAB22244) shows strong nuclear positivity in glandular cells at 1:50-1:200 dilution.
Applications: IHC-P,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy ZNF354B polyclonal antibody now

Add to cart