LRRC16A polyclonal antibody View larger

LRRC16A polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of LRRC16A polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,IF

More info about LRRC16A polyclonal antibody

Brand: Abnova
Reference: PAB22242
Product name: LRRC16A polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant LRRC16A.
Isotype: IgG
Gene id: 55604
Gene name: LRRC16A
Gene alias: CARMIL|CARMIL1a|FLJ20048|FLJ43708|LRRC16|dJ501N12.1|dJ501N12.5
Gene description: leucine rich repeat containing 16A
Immunogen: Recombinant protein corresponding to amino acids of human LRRC16A.
Immunogen sequence/protein sequence: RSDSKSSPQAGRRYGVQVMGSGLLAEMKAKQEKRAACAQKKLGNDAVSQDSSSPALSSVERSDGGGAVPKLHPGLPENRFGLGTPEKNTKAEPKAEA
Protein accession: Q5VZK9
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:2500-1:5000)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB22242-49-187-1.jpg
Application image note: Immunofluorescent staining of human cell line U-251MG with LRRC16A polyclonal antibody (Cat # PAB22242) at 1-4 ug/mL dilution shows positivity in nucleus and cytoplasm.
Applications: IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy LRRC16A polyclonal antibody now

Add to cart