SLC12A3 polyclonal antibody View larger

SLC12A3 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SLC12A3 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about SLC12A3 polyclonal antibody

Brand: Abnova
Reference: PAB22213
Product name: SLC12A3 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant SLC12A3.
Isotype: IgG
Gene id: 6559
Gene name: SLC12A3
Gene alias: FLJ96318|NCCT|TSC
Gene description: solute carrier family 12 (sodium/chloride transporters), member 3
Immunogen: Recombinant protein corresponding to amino acids of human SLC12A3.
Immunogen sequence/protein sequence: LLIPYLLGRKRRWSKCKIRVFVGGQINRMDQERKAIISLLSKFRLGFHEVHILPDINQNPRAEHTKRFEDMIAPFRLNDGFKDEATVNEMRRDCPWKISDEEITKNRVKSLRQVRLNEIVLDYSRDAALIVITLPIGRKGKCPSS
Protein accession: P55017
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB22213-48-2-1.jpg
Application image note: Immunohistochemical staining of human kidney with SLC12A3 polyclonal antibody (Cat # PAB22213) shows strong cytoplasmic positivity in cells in tubules at 1:50-1:200 dilution.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy SLC12A3 polyclonal antibody now

Add to cart