DNAH8 polyclonal antibody View larger

DNAH8 polyclonal antibody

PAB22154_100uL

New product

455,00 € tax excl.

100 UL

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DNAH8 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about DNAH8 polyclonal antibody

Brand: Abnova
Reference: PAB22154
Product name: DNAH8 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant DNAH8.
Isotype: IgG
Gene id: 1769
Gene name: DNAH8
Gene alias: ATPase|FLJ25850|FLJ36115|FLJ36334|hdhc9
Gene description: dynein, axonemal, heavy chain 8
Immunogen: Recombinant protein corresponding to amino acids of human DNAH8.
Immunogen sequence/protein sequence: ILNHKSKHVEEAVRELISIFEQIYEVKYTGKVGKQSEQRKHVVFGSETEEGENNDYEANIVNEFDTHDKEDEFKKECKEVFAFFSHQLLDSLQKATRLSLD
Protein accession: Q96JB1
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB22154-48-302-1.jpg
Application image note: Immunohistochemical staining of human nasopharynx with DNAH8 polyclonal antibody (Cat # PAB22154) shows strong cytoplasmic positivity in respiratory epithelial cells at 1:500-1:1000 dilution.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy DNAH8 polyclonal antibody now

Add to cart