TCTEX1D1 polyclonal antibody View larger

TCTEX1D1 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TCTEX1D1 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about TCTEX1D1 polyclonal antibody

Brand: Abnova
Reference: PAB22147
Product name: TCTEX1D1 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant TCTEX1D1.
Isotype: IgG
Gene id: 200132
Gene name: TCTEX1D1
Gene alias: FLJ40873|MGC125768|RP11-266I14.2
Gene description: Tctex1 domain containing 1
Immunogen: Recombinant protein corresponding to amino acids of human TCTEX1D1.
Immunogen sequence/protein sequence: MMSDNAKGRAAHSWKKRGSISSLSNHEFWRKEIHGRIKDSMSTVSYMEEPSQRDDISRLTVQMENTYQLGPPKHFPVVTVNHI
Protein accession: Q8N7M0
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB22147-48-12-1.jpg
Application image note: Immunohistochemical staining of human testis with TCTEX1D1 polyclonal antibody (Cat # PAB22147) shows cytoplasmic positivity in leydig and Sertoli cells at 1:500-1:1000 dilution.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy TCTEX1D1 polyclonal antibody now

Add to cart