Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of TCHH polyclonal antibody
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | IHC-P |
More info about TCHH polyclonal antibody
| Brand: | Abnova |
| Reference: | PAB22136 |
| Product name: | TCHH polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against recombinant TCHH. |
| Isotype: | IgG |
| Gene id: | 7062 |
| Gene name: | TCHH |
| Gene alias: | MGC157889|MGC157890|THH|THL |
| Gene description: | trichohyalin |
| Immunogen: | Recombinant protein corresponding to amino acids of human TCHH. |
| Immunogen sequence/protein sequence: | QEKSRREEQELWQEEEQKRRQERERKLREEHIRRQQKEEQRHRQVGEIKSQEGKGHGRLLEPGTHQFASVPVRSSPLYEY |
| Protein accession: | Q07283 |
| Form: | Liquid |
| Recommend dilutions: | Immunohistochemistry (1:500-1:1000) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide) |
| Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunohistochemical staining of human placenta with TCHH polyclonal antibody (Cat # PAB22136) shows strong cytoplasmic and nuclear positivity in trophoblastic cells at 1:500-1:1000 dilution. |
| Applications: | IHC-P |
| Shipping condition: | Dry Ice |