SRGAP2 polyclonal antibody View larger

SRGAP2 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SRGAP2 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about SRGAP2 polyclonal antibody

Brand: Abnova
Reference: PAB22120
Product name: SRGAP2 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant SRGAP2.
Isotype: IgG
Gene id: 23380
Gene name: SRGAP2
Gene alias: FNBP2|KIAA0456|srGAP3
Gene description: SLIT-ROBO Rho GTPase activating protein 2
Immunogen: Recombinant protein corresponding to amino acids of human SRGAP2.
Immunogen sequence/protein sequence: LEPLKTSPVVAPTSEPSSPLHTQLLKDPEPAFQRSASTAGDIACAFRPVKSVKMAAPVKPPATRPKPTVFPKTNATSPGVNSSTSPQST
Protein accession: O75044
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB22120-48-47-1.jpg
Application image note: Immunohistochemical staining of human adrenal gland with SRGAP2 polyclonal antibody (Cat # PAB22120) shows strong cytoplasmic and nuclear positivity in cortical cells at 1:10-1:20 dilution.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy SRGAP2 polyclonal antibody now

Add to cart