ODF2L polyclonal antibody View larger

ODF2L polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ODF2L polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about ODF2L polyclonal antibody

Brand: Abnova
Reference: PAB22095
Product name: ODF2L polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant ODF2L.
Isotype: IgG
Gene id: 57489
Gene name: ODF2L
Gene alias: KIAA1229|MGC111060|RP5-977L11.1|dJ977L11.1
Gene description: outer dense fiber of sperm tails 2-like
Immunogen: Recombinant protein corresponding to amino acids of human ODF2L.
Immunogen sequence/protein sequence: LLLPLFKDTIEKINFENANLSALNLKISEQKEILIKELDTFKSVKLALEHLLRKRDYKQTGDNLSSMLLENLTDNESENTNLKKKVFEKE
Protein accession: Q9ULJ1
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB22095-48-42-1.jpg
Application image note: Immunohistochemical staining of human breast with ODF2L polyclonal antibody (Cat # PAB22095) shows moderate cytoplasmic and nuclear positivity combined with staining of luminal membranes in glandular cells at 1:50-1:200 dilution.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy ODF2L polyclonal antibody now

Add to cart