UNK polyclonal antibody View larger

UNK polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of UNK polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about UNK polyclonal antibody

Brand: Abnova
Reference: PAB22088
Product name: UNK polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant UNK.
Isotype: IgG
Gene id: 85451
Gene name: UNK
Gene alias: KIAA1753|ZC3H5|ZC3HDC5
Gene description: unkempt homolog (Drosophila)
Immunogen: Recombinant protein corresponding to amino acids of human UNK.
Immunogen sequence/protein sequence: IYKSTKCNDMQQSGSCPRGPFCAFAHVEQPPLSDDLQPSSAVSSPTQPGPVLYMPSAAGDSVPVSPSSPHAPDLSALLCRNSSLGSPSNLCGSPPGSIRKPPNLEGIVFPGES
Protein accession: Q9C0B0
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB22088-48-44-1.jpg
Application image note: Immunohistochemical staining of human smooth muscle with UNK polyclonal antibody (Cat # PAB22088) shows distinct cytoplasmic positivity in smooth muscle cells.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy UNK polyclonal antibody now

Add to cart