DOPEY1 polyclonal antibody View larger

DOPEY1 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DOPEY1 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about DOPEY1 polyclonal antibody

Brand: Abnova
Reference: PAB22084
Product name: DOPEY1 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant DOPEY1.
Isotype: IgG
Gene id: 23033
Gene name: DOPEY1
Gene alias: FLJ35610|KIAA1117|dJ202D23.2
Gene description: dopey family member 1
Immunogen: Recombinant protein corresponding to amino acids of human DOPEY1.
Immunogen sequence/protein sequence: KLETDCEHVQPPQWLQTLMNACSQASDFSVQSVAISLVMDLVGLTQSVAMVTGENINSVEPAQPLSPNQGRVAVVIRPPLTQGNL
Protein accession: Q5JWR5
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB22084-48-52-1.jpg
Application image note: Immunohistochemical staining of human cerebellum with DOPEY1 polyclonal antibody (Cat # PAB22084) shows cytoplasmic and nuclear positivity in purkinje cells.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy DOPEY1 polyclonal antibody now

Add to cart