NAV1 polyclonal antibody View larger

NAV1 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NAV1 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about NAV1 polyclonal antibody

Brand: Abnova
Reference: PAB22080
Product name: NAV1 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant NAV1.
Isotype: IgG
Gene id: 89796
Gene name: NAV1
Gene alias: DKFZp781D0314|FLJ12560|FLJ14203|KIAA1151|MGC14961|POMFIL3|steerin-1
Gene description: neuron navigator 1
Immunogen: Recombinant protein corresponding to amino acids of human NAV1.
Immunogen sequence/protein sequence: AKSFVKPPSLANLDKVNSNSLDLPSSSDTTHASKVPDLHATSSASGGPLPSCFTPSPAPILNINSASFSQGLELMSGFSVPKETRMYPKLSGLHRSMESLQMPMSLPSAFPSSTPVPTPPAPPAAPTEEETEELTWSGSP
Protein accession: Q8NEY1
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB22080-48-A3-1.jpg
Application image note: Immunohistochemical staining of human stomach with NAV1 polyclonal antibody (Cat # PAB22080) strong cytoplasmic positivity in glandular cells at 1:20-1:50 dilution.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy NAV1 polyclonal antibody now

Add to cart