NUS1 polyclonal antibody View larger

NUS1 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NUS1 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about NUS1 polyclonal antibody

Brand: Abnova
Reference: PAB22042
Product name: NUS1 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant NUS1.
Isotype: IgG
Gene id: 116150
Gene name: NUS1
Gene alias: C6orf68|MGC117249|MGC7199|MGC:7199|NgBR
Gene description: nuclear undecaprenyl pyrophosphate synthase 1 homolog (S. cerevisiae)
Immunogen: Recombinant protein corresponding to amino acids of human NUS1.
Immunogen sequence/protein sequence: ASLLSSNGCPDPDLVLKFGPVDSTLGFLPWHIRLTEIVSLPSHLNISYEDFFSALRQYAACEQRLGK
Protein accession: Q96E22
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB22042-48-258-1.jpg
Application image note: Immunohistochemical staining of human rectum with NUS1 polyclonal antibody (Cat # PAB22042) shows distinct positivity in blood vessels and adipocytes at 1:200-1:500 dilution.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy NUS1 polyclonal antibody now

Add to cart