WDR47 polyclonal antibody View larger

WDR47 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of WDR47 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about WDR47 polyclonal antibody

Brand: Abnova
Reference: PAB22019
Product name: WDR47 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant WDR47.
Isotype: IgG
Gene id: 22911
Gene name: WDR47
Gene alias: FLJ90135|KIAA0893
Gene description: WD repeat domain 47
Immunogen: Recombinant protein corresponding to amino acids of human WDR47.
Immunogen sequence/protein sequence: EHSVIKPPLGDSPGSLSRSKGEEDDKSKKQFVCINILEDTQAVRAVAFHPAGGLYAVGSNSKTLRVCAYPDVIDPSAHETPKQPVV
Protein accession: O94967
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:1000-1:2500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB22019-48-A1-1.jpg
Application image note: Immunohistochemical staining of human liver with WDR47 polyclonal antibody (Cat # PAB22019) shows granular cytoplasmic positivity in hepatocytes at 1:1000-1:2500 dilution.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy WDR47 polyclonal antibody now

Add to cart