TPCN2 polyclonal antibody View larger

TPCN2 polyclonal antibody

PAB22001_100uL

New product

455,00 € tax excl.

100 UL

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TPCN2 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about TPCN2 polyclonal antibody

Brand: Abnova
Reference: PAB22001
Product name: TPCN2 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant TPCN2.
Isotype: IgG
Gene id: 219931
Gene name: TPCN2
Gene alias: FLJ41094|SHEP10|TPC2
Gene description: two pore segment channel 2
Immunogen: Recombinant protein corresponding to amino acids of human TPCN2.
Immunogen sequence/protein sequence: QFRGYLMKSLQTSLFRRRLGTRAAFEVLSSMVGEGGAFPQAVGVKPQNLLQVLQKVQLDSSHRQAMMEKVRSYGSVLLSAEEFQKLFNELDRSVVKEHPPRPEYQSPFLQSAQFLFGHYYF
Protein accession: Q8NHX9
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB22001-48-33-1.jpg
Application image note: Immunohistochemical staining of human prostate with TPCN2 polyclonal antibody (Cat # PAB22001) shows strong membranous positivity in glandular cells.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy TPCN2 polyclonal antibody now

Add to cart