Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Rabbit |
Applications | IHC-P |
Brand: | Abnova |
Reference: | PAB22000 |
Product name: | GPER polyclonal antibody |
Product description: | Rabbit polyclonal antibody raised against recombinant GPER. |
Isotype: | IgG |
Gene id: | 2852 |
Gene name: | GPER |
Gene alias: | CEPR|CMKRL2|DRY12|FEG-1|GPCR-Br|GPR30|LERGU|LERGU2|LyGPR|MGC99678 |
Gene description: | G protein-coupled estrogen receptor 1 |
Immunogen: | Recombinant protein corresponding to amino acids of human GPER. |
Immunogen sequence/protein sequence: | MDVTSQARGVGLEMYPGTAQPAAPNTTSPELNLSHPLLGTALANGTGELSEHQQYVIGLFLS |
Protein accession: | Q99527 |
Form: | Liquid |
Recommend dilutions: | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200) The optimal working dilution should be determined by the end user. |
Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Immunohistochemical staining of human gallbladder with GPER polyclonal antibody (Cat # PAB22000) shows strong membranous and cytoplasmic positivity in glandular cells. |
Applications: | IHC-P |
Shipping condition: | Dry Ice |
Publications: | Estrogen and G protein-coupled estrogen receptor agonist G-1 cause relaxation of human gallbladder.Lee M, Yang Y, Chen Y, Chang B, Li Y, Huang S. Tzu Chi Medical Journal. 2016 May 31. [Epub ahead of print] |