Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of GPER polyclonal antibody
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | IHC-P |
More info about GPER polyclonal antibody
| Brand: | Abnova |
| Reference: | PAB22000 |
| Product name: | GPER polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against recombinant GPER. |
| Isotype: | IgG |
| Gene id: | 2852 |
| Gene name: | GPER |
| Gene alias: | CEPR|CMKRL2|DRY12|FEG-1|GPCR-Br|GPR30|LERGU|LERGU2|LyGPR|MGC99678 |
| Gene description: | G protein-coupled estrogen receptor 1 |
| Immunogen: | Recombinant protein corresponding to amino acids of human GPER. |
| Immunogen sequence/protein sequence: | MDVTSQARGVGLEMYPGTAQPAAPNTTSPELNLSHPLLGTALANGTGELSEHQQYVIGLFLS |
| Protein accession: | Q99527 |
| Form: | Liquid |
| Recommend dilutions: | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
| Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunohistochemical staining of human gallbladder with GPER polyclonal antibody (Cat # PAB22000) shows strong membranous and cytoplasmic positivity in glandular cells. |
| Applications: | IHC-P |
| Shipping condition: | Dry Ice |
| Publications: | Estrogen and G protein-coupled estrogen receptor agonist G-1 cause relaxation of human gallbladder.Lee M, Yang Y, Chen Y, Chang B, Li Y, Huang S. Tzu Chi Medical Journal. 2016 May 31. [Epub ahead of print] |