MTBP polyclonal antibody View larger

MTBP polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MTBP polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,WB-Tr

More info about MTBP polyclonal antibody

Brand: Abnova
Reference: PAB21772
Product name: MTBP polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant MTBP.
Isotype: IgG
Gene id: 27085
Gene name: MTBP
Gene alias: MDM2BP
Gene description: Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa
Immunogen: Recombinant protein corresponding to amino acids of human MTBP.
Immunogen sequence/protein sequence: DAKELLKYFTSDGLPIGDLQPLPIQKGEKTFVLTPELSPGKLQVLPFEKASVCHYHGIEYCLDDRKALERDGGFSELQSRLIRYETQTTCTR
Protein accession: Q96DY7
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB21772-48-52-1.jpg
Application image note: Immunohistochemical staining of human cerebellum with MTBP polyclonal antibody (Cat # PAB21772) shows strong nuclear positivity in purkinje cells.
Applications: IHC-P,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy MTBP polyclonal antibody now

Add to cart