XKR6 polyclonal antibody View larger

XKR6 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of XKR6 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about XKR6 polyclonal antibody

Brand: Abnova
Reference: PAB21751
Product name: XKR6 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant XKR6.
Isotype: IgG
Gene id: 286046
Gene name: XKR6
Gene alias: C8orf21|C8orf7|XRG6
Gene description: XK, Kell blood group complex subunit-related family, member 6
Immunogen: Recombinant protein corresponding to amino acids of human XKR6.
Immunogen sequence/protein sequence: YGVLHPTGPRAKILASSCCAELLWGIPLPPDVEPMAPEIPGYRGTQVTPTRAVTEQQEDLTADTCLPVFQVRPMGPPTPLGRPYLPEGPLIKIDMPR
Protein accession: Q5GH73
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB21751-48-A3-1.jpg
Application image note: Immunohistochemical staining of human stomach with XKR6 polyclonal antibody (Cat # PAB21751) shows strong cytoplasmic positivity in subsets of glandular cells at 1:200-1:500 dilution.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy XKR6 polyclonal antibody now

Add to cart