WDYHV1 polyclonal antibody View larger

WDYHV1 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of WDYHV1 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,WB-Tr

More info about WDYHV1 polyclonal antibody

Brand: Abnova
Reference: PAB21749
Product name: WDYHV1 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant WDYHV1.
Isotype: IgG
Gene id: 55093
Gene name: WDYHV1
Gene alias: C8orf32|FLJ10204
Gene description: WDYHV motif containing 1
Immunogen: Recombinant protein corresponding to amino acids of human WDYHV1.
Immunogen sequence/protein sequence: YLKNFASDRSHMKDSSGNWREPPPPYPCIETGDSKMNLNDFISMDPKVGWGAVYTLSEFTHRFGSK
Protein accession: Q96HA8
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB21749-48-2-1.jpg
Application image note: Immunohistochemical staining of human kidney with WDYHV1 polyclonal antibody (Cat # PAB21749) shows strong cytoplasmic positivity in cells in tubules at 1:50-1:200 dilution.
Applications: IHC-P,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy WDYHV1 polyclonal antibody now

Add to cart