GINS4 polyclonal antibody View larger

GINS4 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GINS4 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,WB-Tr

More info about GINS4 polyclonal antibody

Brand: Abnova
Reference: PAB21736
Product name: GINS4 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant GINS4.
Isotype: IgG
Gene id: 84296
Gene name: GINS4
Gene alias: MGC14799|SLD5
Gene description: GINS complex subunit 4 (Sld5 homolog)
Immunogen: Recombinant protein corresponding to amino acids of human GINS4.
Immunogen sequence/protein sequence: MTEEVDFLGQDSDGGSEEVVLTPAELIERLEQAWMNEKFAPELLESKPEIVECVMEQLEHMEE
Protein accession: Q9BRT9
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB21736-48-2-1.jpg
Application image note: Immunohistochemical staining of human kidney with GINS4 polyclonal antibody (Cat # PAB21736) shows moderate cytopolasmic positivity in tubular cells.
Applications: IHC-P,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy GINS4 polyclonal antibody now

Add to cart