TDRD7 polyclonal antibody View larger

TDRD7 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TDRD7 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about TDRD7 polyclonal antibody

Brand: Abnova
Reference: PAB21707
Product name: TDRD7 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant TDRD7.
Isotype: IgG
Gene id: 23424
Gene name: TDRD7
Gene alias: KIAA1529|PCTAIRE2BP|RP11-508D10.1|TRAP
Gene description: tudor domain containing 7
Immunogen: Recombinant protein corresponding to amino acids of human TDRD7.
Immunogen sequence/protein sequence: LNCSDCSIKVTKVDETRGIAHVYLFTPKNFPDPHRSINRQITNADLWKHQKDVFLSAISSGADSPNSKNGNMPMSGNTGENFRKNLTDVIKKSMVDHTSAFSTEELPPPV
Protein accession: Q8NHU6
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB21707-48-12-1.jpg
Application image note: Immunohistochemical staining of human testis with TDRD7 polyclonal antibody (Cat # PAB21707) shows cytoplasmic and nuclear positivity in subsets of testicular cells at 1:500-1:1000 dilution.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy TDRD7 polyclonal antibody now

Add to cart