USH1G polyclonal antibody View larger

USH1G polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of USH1G polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about USH1G polyclonal antibody

Brand: Abnova
Reference: PAB21685
Product name: USH1G polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant USH1G.
Isotype: IgG
Gene id: 124590
Gene name: USH1G
Gene alias: ANKS4A|FLJ33924|SANS
Gene description: Usher syndrome 1G (autosomal recessive)
Immunogen: Recombinant protein corresponding to amino acids of human USH1G.
Immunogen sequence/protein sequence: NIWCLDNDYHTPLDMAAMKGHMECVRYLDSIAAKQSSLNPKLVGKLKDKAFREAERRIRECAKLQRRHHERMER
Protein accession: Q495M9
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB21685-48-71-1.jpg
Application image note: Immunohistochemical staining of human thyroid gland with USH1G polyclonal antibody (Cat # PAB21685) shows strong cytoplasmic and nuclear positivity in glandular cells at 1:500-1:1000 dilution.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy USH1G polyclonal antibody now

Add to cart