FAM75E1 polyclonal antibody View larger

FAM75E1 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FAM75E1 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about FAM75E1 polyclonal antibody

Brand: Abnova
Reference: PAB21669
Product name: FAM75E1 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant FAM75E1.
Isotype: IgG
Gene id: 286234
Gene name: FAM75E1
Gene alias: C9orf79
Gene description: family with sequence similarity 75, member E1
Immunogen: Recombinant protein corresponding to amino acids of human FAM75E1.
Immunogen sequence/protein sequence: VPTVSGPLAAPPPEQEGVQRPPRGSQSADTHGRSEAFPTGHKGRGCSQPPTCSLVGRTWQSRTVLESGKPKPRLEGSMGSEMAGNEAWLESESMSPGDPCSSRALQVLSIGSQWARAEDA
Protein accession: Q6ZUB1
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB21669-48-36-1.jpg
Application image note: Immunohistochemical staining of human small intestine with FAM75E1 polyclonal antibody (Cat # PAB21669) shows strong membranous positivity in glandular cells.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy FAM75E1 polyclonal antibody now

Add to cart