TRIM41 polyclonal antibody View larger

TRIM41 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TRIM41 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about TRIM41 polyclonal antibody

Brand: Abnova
Reference: PAB21661
Product name: TRIM41 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant TRIM41.
Isotype: IgG
Gene id: 90933
Gene name: TRIM41
Gene alias: MGC1127|MGC31991|RINCK
Gene description: tripartite motif-containing 41
Immunogen: Recombinant protein corresponding to amino acids of human TRIM41.
Immunogen sequence/protein sequence: RESTHHKEKVGPGGSSVGSGDASSSRHHHRRRRLHLPQQPLLQREVWCVGTNGKRYQAQSSTEQTLLSPSEKPRRFGVYLDYEA
Protein accession: Q8WV44
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB21661-48-I6-1.jpg
Application image note: Immunohistochemical staining of human duodenum with TRIM41 polyclonal antibody (Cat # PAB21661) strong cytoplasmic positivity in glandular cells.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy TRIM41 polyclonal antibody now

Add to cart