TTI2 polyclonal antibody View larger

TTI2 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TTI2 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,WB-Tr

More info about TTI2 polyclonal antibody

Brand: Abnova
Reference: PAB21582
Product name: TTI2 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant TTI2.
Isotype: IgG
Gene id: 80185
Gene name: TTI2
Gene alias: C8orf41
Gene description: TELO2 interacting protein 2
Immunogen: Recombinant protein corresponding to amino acids of human TTI2.
Immunogen sequence/protein sequence: LLGKVETAKNSLVGPAWQTGLHHLAGPVYIFAITHSLEQPWTTPRSREVAREVLTSLLQVTECGSVAGFLHGENEDEKG
Protein accession: Q6NXR4
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB21582-48-44-1.jpg
Application image note: Immunohistochemical staining of human smooth muscle with TTI2 polyclonal antibody (Cat # PAB21582) shows strong cytoplasmic positivity at 1:20-1:50 dilution.
Applications: IHC-P,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy TTI2 polyclonal antibody now

Add to cart