AGAP2 polyclonal antibody View larger

AGAP2 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of AGAP2 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,IF

More info about AGAP2 polyclonal antibody

Brand: Abnova
Reference: PAB21576
Product name: AGAP2 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant AGAP2.
Isotype: IgG
Gene id: 116986
Gene name: AGAP2
Gene alias: CENTG1|FLJ16430|GGAP2|KIAA0167|PIKE
Gene description: ArfGAP with GTPase domain, ankyrin repeat and PH domain 2
Immunogen: Recombinant protein corresponding to amino acids of human AGAP2.
Immunogen sequence/protein sequence: PSASINGLVKDMSTVQMGEGLEATTPMPSPSPSPSSLQPPPDQTSKHLLKPDRNLARALSTDCTPSGDLSPLSREPPPSPMVKKQRRKKLTTPSKTE
Protein accession: Q99490
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50-1:200)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB21576-49-187-1.jpg
Application image note: Immunofluorescent staining of human cell line U-251MG with AGAP2 polyclonal antibody (Cat # PAB21576) at 1-4 ug/mL dilution shows positivity in nucleus, nucleoli and mitochondria.
Applications: IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy AGAP2 polyclonal antibody now

Add to cart