AMZ2 polyclonal antibody View larger

AMZ2 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of AMZ2 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,WB-Tr

More info about AMZ2 polyclonal antibody

Brand: Abnova
Reference: PAB21554
Product name: AMZ2 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant AMZ2.
Isotype: IgG
Gene id: 51321
Gene name: AMZ2
Gene alias: -
Gene description: archaelysin family metallopeptidase 2
Immunogen: Recombinant protein corresponding to amino acids of human AMZ2.
Immunogen sequence/protein sequence: AGEQRLMNEAFQPASDLFGPITLHSPSDWITSHPEAPQDFEQFFSDPYRKTPSPNKRSIYIQSIGSLGNTRIIS
Protein accession: Q86W34
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:500-1:1000)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB21554-48-12-1.jpg
Application image note: Immunohistochemical staining of human testis with AMZ2 polyclonal antibody (Cat # PAB21554) shows strong nuclear and cytoplasmic positivity in seminiferus duct cells at 1:500-1:1000 dilution.
Applications: IHC-P,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy AMZ2 polyclonal antibody now

Add to cart