NEFM polyclonal antibody View larger

NEFM polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NEFM polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,IF

More info about NEFM polyclonal antibody

Brand: Abnova
Reference: PAB21539
Product name: NEFM polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant NEFM.
Isotype: IgG
Gene id: 4741
Gene name: NEFM
Gene alias: NEF3|NF-M|NFM
Gene description: neurofilament, medium polypeptide
Immunogen: Recombinant protein corresponding to amino acids of human NEFM.
Immunogen sequence/protein sequence: YIEKVHYLEQQNKEIEAEIQALRQKQASHAQLGDAYDQEIRELRATLEMVNHEKAQVQLDSDHLEEDIHRLKERFEEEARLRDDTEAAIRALRKDIEEASLVKVELDKKVQSLQDEVAFLRSNH
Protein accession: P07197
Form: Liquid
Recommend dilutions: The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB21539-48-52-1.jpg
Application image note: Immunohistochemical staining of human cerebellum with NEFM polyclonal antibody (Cat # PAB21539) shows moderate cytoplasmic positivity in Purkinje cells.
Applications: IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy NEFM polyclonal antibody now

Add to cart