MSL1 polyclonal antibody View larger

MSL1 polyclonal antibody

PAB21505_100uL

New product

455,00 € tax excl.

100 UL

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MSL1 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,IF

More info about MSL1 polyclonal antibody

Brand: Abnova
Reference: PAB21505
Product name: MSL1 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant MSL1.
Isotype: IgG
Gene id: 339287
Gene name: MSL1
Gene alias: DKFZp686J17211|MGC141861|MSL-1|hMSL1
Gene description: male-specific lethal 1 homolog (Drosophila)
Immunogen: Recombinant protein corresponding to amino acids of human MSL1.
Immunogen sequence/protein sequence: QQQQLQAKEKEIEELKSERDTLLARIERMERRMQLVKKDNEKERHKLFQGYETEEREETELSEKIKLECQPELSETSQTLPPKPFSCGRSGKGHK
Protein accession: Q68DK7
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:200-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB21505-49-4-1.jpg
Application image note: Immunofluorescent staining of human cell line A-431 with MSL1 polyclonal antibody (Cat # PAB21505) at 1-4 ug/mL dilution shows positivity in nuclei but not nucleoli.
Applications: IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy MSL1 polyclonal antibody now

Add to cart