RSAD1 polyclonal antibody View larger

RSAD1 polyclonal antibody

PAB21496_100uL

New product

455,00 € tax excl.

100 UL

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RSAD1 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about RSAD1 polyclonal antibody

Brand: Abnova
Reference: PAB21496
Product name: RSAD1 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant RSAD1.
Isotype: IgG
Gene id: 55316
Gene name: RSAD1
Gene alias: FLJ11164|FLJ20975
Gene description: radical S-adenosyl methionine domain containing 1
Immunogen: Recombinant protein corresponding to amino acids of human RSAD1.
Immunogen sequence/protein sequence: LLEEVLALGLRTDVGITHQHWQQFEPQLTLWDVFGANKEVQELLERGLLQLDHRGLRCSWEGLAVLDSLLLTLLP
Protein accession: Q9HA92
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB21496-48-A3-1.jpg
Application image note: Immunohistochemical staining of human stomach with RSAD1 polyclonal antibody (Cat # PAB21496) shows strong cytoplasmic positivity in Parietal cells.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy RSAD1 polyclonal antibody now

Add to cart