PERP polyclonal antibody View larger

PERP polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PERP polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,WB-Tr

More info about PERP polyclonal antibody

Brand: Abnova
Reference: PAB21486
Product name: PERP polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant PERP.
Isotype: IgG
Gene id: 64065
Gene name: PERP
Gene alias: KCP1|KRTCAP1|PIGPC1|RP3-496H19.1|THW|dJ496H19.1
Gene description: PERP, TP53 apoptosis effector
Immunogen: Recombinant protein corresponding to amino acids of human PERP.
Immunogen sequence/protein sequence: LQSSDHGQTSSLWWKCSQEGGGSGSYEEGCQSLMEYAW
Protein accession: Q96FX8
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB21486-48-72-1.jpg
Application image note: Immunohistochemical staining of human skin with PERP polyclonal antibody (Cat # PAB21486) shows moderate positivity in stratum corneum.
Applications: IHC-P,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy PERP polyclonal antibody now

Add to cart