MLF1IP polyclonal antibody View larger

MLF1IP polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MLF1IP polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,IF

More info about MLF1IP polyclonal antibody

Brand: Abnova
Reference: PAB21473
Product name: MLF1IP polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant MLF1IP.
Isotype: IgG
Gene id: 79682
Gene name: MLF1IP
Gene alias: CENP-50|CENP-U|CENP-U(50)|CENP50|CENPU|FLJ23468|KLIP1|PBIP1
Gene description: MLF1 interacting protein
Immunogen: Recombinant protein corresponding to amino acids of human MLF1IP.
Immunogen sequence/protein sequence: EETYETFDPPLHSTAIYADEEEFSKHCGLSLSSTPPGKEAKRSSDTSGNEASEIESVKISAKKPGRKLRPISDDSESIEESDTRRKVKSAEKISTQRHEVIRTTASSELSEKPAESV
Protein accession: Q71F23
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50-1:200)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB21473-49-23-1.jpg
Application image note: Immunofluorescent staining of human cell line U-2 OS with MLF1IP polyclonal antibody (Cat # PAB21473) at 1-4 ug/mL dilution shows positivity in nucleus, cytoplasm and centrosome.
Applications: IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy MLF1IP polyclonal antibody now

Add to cart